top of page

CircRNA

Gene

chr7|152220522|152230321|-|7|circRNA|KMT2C|ENST00000262189.10|23,22,21,20,19,18,17

KMT2C

CircRNA UID

circKMT2C(23,22,21,20,19,18,17)

Open Reading Frame (ORF)

LTESGMTQLQSLTVTVPRRKRSKPKLKLKIINQNSVAVLQTPPDIQSEHSRDGEMDDSRGVYCRYFIK

Peptide

GVYCRYFIK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page