top of page

CircRNA

Gene

chr7|152157760|152178010|—|8|circRNA|KMT2C|ENST00000473186.5|31,30,29,28,27,26,25,24

KMT2C

Open Reading Frame (ORF)

MMEKRLLCILVIQIYLRKEPIEKLLAPVQMSFRHPLNYLLKM

Peptide

LLAPVQMSFR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page