top of page

CircRNA

Gene

chr7|149266334|149278527|+|4|circRNA|ZNF783|ENST00000434415.5|2,3,4,5

ZNF783

CircRNA UID

circZNF783(2,3,4,5)

Open Reading Frame (ORF)

LKEGQAPKQQQDSEARVAPAGPEAGPRDRQAHRGPESFDTLAPASC

Peptide

VAPAGPEAGPR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page