top of page

CircRNA

Gene

chr7|14574211|14718685|—|15|circRNA|DGKB|ENST00000399322.7|19,18,17,16,15,14,13,12,11,10,9,8,7,6,5

DGKB

Open Reading Frame (ORF)

LKTAQKSCWTGGSLKSYLMTKMRKETQCLTVSSIITFPLAWSENE

Peptide

ETQCLTVSSIITFPLAWSENE

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA,PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page