top of page

CircRNA

Gene

chr7|143292299|143292698|+|2|circRNA|CASP2|ENST00000310447.9|3,4

CASP2

CircRNA UID

circCASP2(3,4)

Open Reading Frame (ORF)

LSPLQEAPPVDRPKWAVSARMWNSSTCCLRGVPKLLMPSVKH

Peptide

LLMPSVKH

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page