top of page

CircRNA

Gene

chr7|140807959|140834872|-|3|circRNA|BRAF|NM_004333|5,4,3

BRAF

Open Reading Frame (ORF)

LVGTLIFPGLLEKNCMWKCWRMFHLQHTTLPMKNTPAS

Peptide

CWRMFHLQHTTLPMK

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAG

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page