top of page

CircRNA

Gene

chr7|140343411|140348767|—|4|circRNA|SLC37A3|ENST00000477571.5|12,11,10,9

SLC37A3

Open Reading Frame (ORF)

LLFLRTWVARSSSKGAVKLWPLSQELWMVRGALELQWASTHWPTPA

Peptide

GALELQWASTHWPTPA

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page