top of page

CircRNA

Gene

chr7|140094055|140102160|-|7|circRNA|KDM7A|NM_030647|18,17,16,15,14,13,12

KDM7A

CircRNA UID

circKDM7A(18,17,16,15,14,13,12)

Open Reading Frame (ORF)

LILPDFILRRKTANQLNLREFLLCVQFHDPQMKQLPHTIPEER

Peptide

EFLLCVQFHDPQMKQLPHTIPEER

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

24

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page