top of page

CircRNA

Gene

chr7|13931501|13935896|—|2|circRNA|ETV1|ENST00000430479.5|9,8

ETV1

Open Reading Frame (ORF)

LNPVTPFLLCRRCQGKDVLCTNARCLSQTSPSHHKALSRSTTTQCMNTTPWLAVRPAKAFPLL

Peptide

CLSQTSPSHHK

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page