top of page

CircRNA

Gene

chr7|139061035|139084032|-|7|circRNA|ZC3HAV1|ENST00000242351.9|9,8,7,6,5,4,3

ZC3HAV1

CircRNA UID

circZC3HAV1(9,8,7,6,5,4,3)

Open Reading Frame (ORF)

MIQTNIASKTQKDVIRRPTFVPQWYVQQMKRGPEYAKVIRERVGSRFVTSSHRVQDSTSVTTSPEGTVVFPTASGPIT

Peptide

FVTSSHR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page