top of page

CircRNA

Gene

chr7|138871156|138871362|-|1|circRNA|KIAA1549|ENST00000440172.5|13

KIAA1549

CircRNA UID

circKIAA1549(13)

Open Reading Frame (ORF)

MSSTHQPPSSSTWTGSPAPRRLAGGSPVRSSLSPCSRSRHLPSSAPPQPTEWRKAIKSTKRATTAQFGK

Peptide

LAGGSPVR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page