top of page

CircRNA

Gene

chr7|135205927|135209755|—|4|circRNA|WDR91|NM_014149|5,4,3,2

WDR91

Open Reading Frame (ORF)

LQAEIHRLKKEEQQPEEEEALVQHKLPPYVSNMDRLGDSELWIRLWTSCSS

Peptide

LGDSELWIR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page