top of page

CircRNA

Gene

chr7|134941091|134950514|+|3|circRNA|CALD1|ENST00000417172.5|6,7,8

CALD1

Open Reading Frame (ORF)

LKGEEQKLLRNARRCQKMACQMTRNHSSVSLLKVHLSRSKMKRLKRTKNPKKKLRASWIERRDLQKLSRRMENS

Peptide

MACQMTRNHSSVSLLK

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page