top of page

CircRNA

Gene

chr7|130554480|130564393|-|5|circRNA|COPG2|ENST00000425248.5|14,13,12,11,10

COPG2

Open Reading Frame (ORF)

LRTVNTLFWLLRFYTCWAKRALERLSPPNISVLFLIGLSWRMRLSELP

Peptide

LRTVNTLFWLLR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page