top of page

CircRNA

Gene

chr7|130173631|130178527|—|3|rescued|TMEM209|ENST00000397622|98,77,109|0,193,4787

TMEM209

Open Reading Frame (ORF)

MLQMRMFFAFIRVLSTLPIMSSSTSVMYTTCQRG

Peptide

VLSTLPIMSSSTSVMYTTCQR

ORF Found in Long-Read

true

Peptide Length

21

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

21

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

Rescued

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page