top of page

CircRNA

Gene

chr7|129205609|129206369|+|2|circRNA|SMO|NM_005631|4,5

SMO

Open Reading Frame (ORF)

LVWFGLWSSPMPGTLPSKPWAPPTSLSRARPPTSTCSPGHSPLSSLWQSLLWRRPHSWLTGGTRIATLLLFSSTSMRASLWAALAGWPSSWMVPAERSSAVQMAP

Peptide

ASLWAALAGWPSSWMVPAER

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

20

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page