top of page

CircRNA

Gene

chr7|128982247|128993914|—|6|circRNA|TNPO3|ENST00000265388.9|14,13,12,11,10,9

TNPO3

Open Reading Frame (ORF)

LLSQEPSNGISSDPTVFLDRLAVIFRRGFLRRLMTLGSFA

Peptide

LMTLGSFA

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page