top of page

CircRNA

Gene

chr7|128967279|129001234|—|16|circRNA|TNPO3|ENST00000265388.9|21,20,19,18,17,16,15,14,13,12,11,10,9,8,7,6

TNPO3

Open Reading Frame (ORF)

LPKETTVGAVTVTHKQLTDFHKQVTSNRIRPRLTYMKLLRTVYAQLSMPLRMWRLTCH

Peptide

TVYAQLSMPLRMWR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page