top of page

CircRNA

Gene

chr7|128748572|128759852|+|4|circRNA|CALU|ENST00000535011.6|2,3,4,5

CALU

Open Reading Frame (ORF)

MSLSSVTRFTMMLRVLIMTMMPSWVLKKQRPLIS

Peptide

FTMMLRVLIMTMMPSWVLK

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page