top of page

CircRNA

Gene

chr7|128626294|128626530|+|1|circRNA|RP11—274B21.14|TCONS_l2_00026208|3

RP11-274B21.14

Open Reading Frame (ORF)

LSCGFMAFLPFVVLAKWNLNDILSRWINPSFPVLEYRKWMDK

Peptide

WINPSFPVLEYR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page