top of page

CircRNA

Gene

chr7|122471374|122474517|-|2|circRNA|CADPS2|NM_001009571|13,12

CADPS2

Open Reading Frame (ORF)

LMEHSENGAVIDPTLLHYSFAFCASHVHGNRCRSFSETWYG

Peptide

CRSFSETWYG

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page