top of page

CircRNA

Gene

chr7|112775175|112784953|-|2|circRNA|TMEM168|NM_001287497|4,3

TMEM168

Open Reading Frame (ORF)

MLRSIRKMGKNSKFLNFGNFYSWSFCSWNRQHTLLLFFNGSSKFKSLQSLVWILAWPPMFS

Peptide

QHTLLLFFNGSSK

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page