top of page

CircRNA

Gene

chr7|112455762|112468115|+|8|circRNA|IFRD1|ENST00000005558.8|3,4,5,6,7,8,9,10

IFRD1

Open Reading Frame (ORF)

MESLTQMLRALATDGNKHRAKVDKRKQRSVFRDVLRAVEVASIEMFSLLVMKMHQLKQ

Peptide

AVEVASIEMFSLLVMK

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

9

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page