top of page

CircRNA

Gene

chr7|111977131|112004131|-|7|circRNA|DOCK4|NM_014705|8,7,6,5,4,3,2

DOCK4

CircRNA UID

circDOCK4(8,7,6,5,4,3,2)

Open Reading Frame (ORF)

MEHRHRKKDTPVQASSHHLFVQMKSLMCSNLGEELEVIFSLFDSKENRPISYCQFPRNRSIWPVIGNWRYSSDPGEV

Peptide

ENRPISYCQFPR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page