top of page

CircRNA

Gene

chr7|107951225|107955630|-|4|circRNA|LAMB1|NM_002291|24,23,22,21

LAMB1

Open Reading Frame (ORF)

LGLEAAPAASARNSSGETPTWSAEVLGWLLWRPHHWVRRSLPPLPLPRWSRQWTPVCQELLPRSCYFTACLCL

Peptide

LGLEAAPAASAR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page