top of page

CircRNA

Gene

chr7|105505954|105508544|-|3|circRNA|PUS7|ENST00000481939.5|4,3,2

PUS7

CircRNA UID

circPUS7(4,3,2)

Open Reading Frame (ORF)

LTAEEKQRLEELQLFKNKETSVAIEVFLNVFLEP

Peptide

ETSVAIEVFLNVFLEP

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page