top of page

CircRNA

Gene

chr7|105481051|105506056|—|6|circRNA|PUS7|ENST00000481939.5|9,8,7,6,5,4

PUS7

Open Reading Frame (ORF)

LDLLTTMECKDLEPQLSLRIRLEGPFRRHIYSFDS

Peptide

LEGPFRR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page