top of page

CircRNA

Gene

chr7|104136780|104165282|-|3|circRNA|ORC5|ENST00000297431.8|13,12,11

ORC5

Open Reading Frame (ORF)

LLTLVGHDDQLDGPKYKCTVSLDFIRAIASIMEKSRKPTF

Peptide

CTVSLDFIRAIASIMEK

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page