top of page

CircRNA

Gene

chr7|102465816|102466270|+|2|circRNA|LRWD1|ENST00000292616.9|2,3

LRWD1

CircRNA UID

circLRWD1(2,3)

Open Reading Frame (ORF)

LKVSFLLPTLRKVNGKDASSTYSQVENLNRELTSRPVRIGAAFRAPGPQTPVPPDAAAGA

Peptide

APGPQTPVPPDAAAGA

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page