top of page

CircRNA

Gene

chr7|102395976|102404683|+|4|circRNA|PRKRIP1|ENST00000496391.5|5,6,7,8

PRKRIP1

CircRNA UID

circPRKRIP1(5,6,7,8)

Open Reading Frame (ORF)

MQSFRKDWKRIKLLQRSRPQSAGRSGDCQKWRRGHQIQGSARTKPGGEESRRGGGAESISGAARWHEDARGDWRGRLGPGYSGTEGHLPFRDVSI

Peptide

GGGAESISGAAR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page