top of page

CircRNA

Gene

chr7|100893164|100894255|-|1|circRNA|ACHE|ENST00000411582.1|2

ACHE

Open Reading Frame (ORF)

LGRAREPPRWACTCCPRPAGACSTGPCCRAVPPMDPGPRWAWERPVAGPRSWPTLWAVLQAALVGMTQSW

Peptide

AVPPMDPGPR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page