top of page

CircRNA

Gene

chr7|100818519|100820296|—|3|circRNA|EPHB4|ENST00000360620.7|7,6,5

EPHB4

Open Reading Frame (ORF)

LFPGHPVGLCWTTRSNTMRSLCPGHLQAPVRRRVLPAMPSQ

Peptide

LFPGHPVGLCWTTRSNTMR

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

19

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page