top of page

CircRNA

Gene

chr6|99482752|99508782|-|6|circRNA|USP45|NM_001080481|8,7,6,5,4,3

USP45

Open Reading Frame (ORF)

LVVELSRPGPLTSALFLFLHSMKETEKGPLSPKVLFNQLCQNRFNLPTCKSCYQRESCKESNS

Peptide

VLFNQLCQNRFNLPTCK

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

9

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page