top of page

CircRNA

Gene

chr6|99408286|99409172|-|1|ciRNA|PNISR|ENST00000369239.9|6

PNISR

Open Reading Frame (ORF)

MALKKGMIFNGIFFKFTHKFVEIFYLTDLRIFCSYLT

Peptide

GMIFNGIFFK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page