top of page

CircRNA

Gene

chr6|90088960|90206681|-|2|circRNA|BACH2|NM_001170794|3,2

BACH2

CircRNA UID

circBACH2(3,2)

Open Reading Frame (ORF)

LPHKTLGSMSEWIARAFSSLPSPSSLHPKTRRQHRTWKNYIAAVCFRK

Peptide

AFSSLPSPSSLHPK

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page