top of page

CircRNA

Gene

chr6|89738325|89743714|-|4|circRNA|MDN1|ENST00000369393.7|33,32,31,30

MDN1

Open Reading Frame (ORF)

LSPALRNRFTEIWCPQSTSREDLIQIISHNLRPGLCLGRIDPKGVGKLLSVRYLQPWQIRNYTLSAATYTWRHQTSWVACGQ

Peptide

IDPKGVGK

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

6

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page