top of page

CircRNA

Gene

chr6|89652991|89668151|-|11|circRNA|MDN1|ENST00000369393.7|94,93,92,91,90,89,88,87,86,85,84

MDN1

Open Reading Frame (ORF)

LMRWKWRSKLLKQRKTKTPEQTKPIRRQKMRNQKEAESLPFIQLINSSWTRSSRDFACPKNLWKIQLEREQLSSMTMREVELEKARA

Peptide

IQLEREQLSSMTMR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page