top of page

CircRNA

Gene

chr6|85618817|85619417|-|2|circRNA|SYNCRIP|NM_001159676|9,8

SYNCRIP

CircRNA UID

circSYNCRIP(9,8)

Open Reading Frame (ORF)

MAKTWREKILKLFLPSHQIRKGKKEKLRGKQQKIKCKSAVCTQPCQYCNRRDFRKGI

Peptide

ILKLFLPSHQIR

ORF Found in Long-Read

true

Peptide Length

12

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

true

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page