top of page

CircRNA

Gene

chr6|84200788|84221171|-|8|circRNA|CEP162|ENST00000257766.8|9,8,7,6,5,4,3,2

CEP162

Open Reading Frame (ORF)

LLDSLDSVAEVNLDEQDKITPKPRCLPEMTENEMTGTAFR

Peptide

CLPEMTENEMTGTAFR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page