top of page

CircRNA

Gene

chr6|83137172|83145658|+|5|circRNA|DOPEY1|ENST00000237163.9|21,22,23,24,25

DOPEY1

Open Reading Frame (ORF)

LLWKKVSQRTALLISQRMNLTMAARCSHNFLRCFRG

Peptide

CSHNFLRCFR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page