top of page

CircRNA

Gene

chr6|63576435|63579331|+|4|circRNA|PTP4A1|ENST00000370651.5|2,3,4,5

PTP4A1

CircRNA UID

circPTP4A1(2,3,4,5)

Open Reading Frame (ORF)

LITAPPRSPHKSGYPGHRSVELKSTEHFTRVLTWMG

Peptide

LITAPPR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

TranCirc

Potential Cryptic Translation

false

bottom of page