top of page

CircRNA

Gene

chr6|57193841|57207713|-|4|circRNA|RAB23|ENST00000468148.5|6,5,4,3

RAB23

Open Reading Frame (ORF)

LAEKYLQKLKQQIAEDPELTHSSSNKIELMMKMSD

Peptide

QQIAEDPELTHSSSNKIELMMK

ORF Found in Long-Read

false

Peptide Length

22

Stop Codon

TAA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page