top of page

CircRNA

Gene

chr6|57133041|57142095|+|4|circRNA|ZNF451|ENST00000370706.8|6,7,8,9

ZNF451

Open Reading Frame (ORF)

LPQDTAFPHGAHCPFQDSKQAQLIVEQKVHSEEEATRGCLGNQFYVL

Peptide

GCLGNQFYVL

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page