top of page

CircRNA

Gene

chr6|57128728|57148693|+|6|circRNA|ZNF451|ENST00000370706.8|5,6,7,8,9,10

ZNF451

CircRNA UID

circZNF451(5,6,7,8,9,10)

Open Reading Frame (ORF)

LWMKPAPKIISRIQDTKSESLTQWKNQSYSIATAAKGTRILLLTCIYCWINQNFHHLKEPCLLKNLAHWSALPFQKRR

Peptide

LWMKPAPK

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

TranCirc

Potential Cryptic Translation

false

bottom of page