top of page

CircRNA

Gene

chr6|56851396|56900621|-|2|circRNA|DST|NM_001144769|4,3

DST

CircRNA UID

circDST(4,3)

Open Reading Frame (ORF)

LRIFPMRMISARNLAPHPQLRETPYPGICLNMRDRKERFKGAQCWTLPRGQCFG

Peptide

FKGAQCWTLPR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC,TransCirc

riboCIRC,TranCirc

Potential Cryptic Translation

false

bottom of page