top of page

CircRNA

Gene

chr6|56508528|56573887|—|25|circRNA|DST|NM_015548|56,55,54,53,52,51,50,49,48,47,46,45,44,43,42,41,40,39,38,37,36,35,34,33,32

DST

Open Reading Frame (ORF)

MVFIWENIHTLVEEREAKLLDVMELAEKFWCDHMSLIVTIKDTQDFIRDLEDPGIDPSVVKQQQEAAEMTLLGDMRICPSLLMNEMKNSR

Peptide

QQQEAAEMTLLGDMRICPSLLMNEMK

ORF Found in Long-Read

false

Peptide Length

26

Stop Codon

TAA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

19

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page