top of page

CircRNA

Gene

chr6|53882976|53896495|+|1|ciRNA|LRRC1|ENST00000487251.5|5

LRRC1

CircRNA UID

ciLRRC1(5)

Open Reading Frame (ORF)

MPLDLLIKNSALKLSGGEEDRKPSIHSRCMVSVAEKTVVFYCEFHACTIHFCCIKCQIFIM

Peptide

LSGGEEDR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page