top of page

CircRNA

Gene

chr6|52985583|52987356|—|1|ciRNA|GSTA4|ENST00000486559.5|1

GSTA4

Open Reading Frame (ORF)

LEATRHVLSTPLASPLTCSECSNPQGQAVPYTGISPQGLVCGKCWIQVC

Peptide

LEATRHVLSTPLASPLTCSECSNPQGQAVPYTGISPQGLVCGK

ORF Found in Long-Read

false

Peptide Length

43

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

43

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page