top of page

CircRNA

Gene

chr6|51867862|51887245|-|5|circRNA|PKHD1|ENST00000371117.7|48,47,46,45,44

PKHD1

CircRNA UID

circPKHD1(48,47,46,45,44)

Open Reading Frame (ORF)

LKFTNSSNLVAFPFPHAAILEDLDGSLSGKNRSHILASMETLSASCLVNSSFGRVVHGSACGGGVLFHRMSIGLGTECVVLAMATFSIS

Peptide

MSIGLGTECVVLAMATFSIS

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

13

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page