top of page

CircRNA

Gene

chr6|44932652|45365301|—|9|circRNA|SUPT3H|ENST00000475057.5|10,9,8,7,6,5,4,3,2

SUPT3H

Open Reading Frame (ORF)

LQPVVLRLTAMPSSPATSERPFDATATGLAHFPHSQ

Peptide

LTAMPSSPATSERPFDATATGLAHFPHSQ

ORF Found in Long-Read

false

Peptide Length

29

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

29

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page